PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01603.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 351aa    MW: 38414.2 Da    PI: 8.4299
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01603.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.75.3e-54171441128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeelvv+yLk+kv++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkat
  Rsa1.0_01603.1_g00006.1  17 LPPGFRFHPTDEELVVHYLKRKVASAPLPV-AIIAEVDLYKFDPWELPAKASFGEREWYFFSPRDRKYPNGARPNRAATSGYWKAT 101
                              79****************************.88***************999999******************************** PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk+vl++ ++++vg+kk Lvfy+g+ pkg+k+dW+mheyr+
  Rsa1.0_01603.1_g00006.1 102 GTDKPVLASdGKQKVGVKKALVFYSGKPPKGVKSDWIMHEYRI 144
                              *******9967788***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.5E-6512178IPR003441NAC domain
PROSITE profilePS5100562.15917178IPR003441NAC domain
PfamPF023652.9E-2818144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MESIESSGGP TPPQPNLPPG FRFHPTDEEL VVHYLKRKVA SAPLPVAIIA EVDLYKFDPW  60
ELPAKASFGE REWYFFSPRD RKYPNGARPN RAATSGYWKA TGTDKPVLAS DGKQKVGVKK  120
ALVFYSGKPP KGVKSDWIMH EYRIIDNKPN YRPPACDFAN KNSSLRLDDW VLCRIYKKNN  180
ASRHVDNDKD EGMIDYIFRK VPPSSSSGLH HNVSRSMNIF PGKSSGGYGI FSDGDSGLYD  240
GSSMVCSNGA GSVNVNVSNG NPNGLNPATS SGPMMMMANL KRALSPVAEE EQDASPSKRF  300
HCVGGGDCLN MSSSVMEETP PLMHQQGGVL GDDGLLRTAS YQLPGLNWYS S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-741418314170NAC domain-containing protein 19
4dul_A3e-741418314170NAC domain-containing protein 19
1ut7_B3e-741418314170NO APICAL MERISTEM PROTEIN
1ut7_A3e-741418314170NO APICAL MERISTEM PROTEIN
1ut4_B3e-741418314170NO APICAL MERISTEM PROTEIN
1ut4_A3e-741418314170NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013741023.10.0PREDICTED: NAC transcription factor 56-like
SwissprotQ9LD440.0NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A0D3BBH60.0A0A0D3BBH6_BRAOL; Uncharacterized protein
STRINGBra001597.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-175NAC domain containing protein 2